Description | HMGB1/HMG-1(Human)GST-TaggedRecombinantProtein Source:WheatGerm(invitro) AminoAcidSequence:MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
Protein/PeptideType | RecombinantProtein |
Gene | HMGB1 |
ApplicationNotes | UsefulinWesternBlotandELISA.Thisproteinhasnotbeentestedforanyfunctionality.Thisproductmaycontainendotoxinsandisnotsuitableforusewithlivecells. | |
Publications |
|
Storage | Storeat-80C.Avoidfreeze-thawcycles. |
Buffer | 50mMTris-HCl,10mMreducedGlutathione,pH8.0intheelutionbuffer. |
Accelerate Scientific Discovery by Developing Unique Products
The mission of Novus Biologicals, LLC is to accelerate scientific discovery by developing and marketing unique products for the lifesciences. Novus Biologicals is also organized to provide the biological research community with a mechanism for commercializing unique biological materials. We also focus on continually monitoring scientific trends and supply materials to serve these trends. By making these products widely available to institutional and commercial researchers, Novus Biologicals plays an important role in furthering biological research.
All of Novus Biologicals products are supplied with detailed technical information and ongoing support. By serving both niche and emerging markets, Novus Biologicals has built solid partnerships with our customers. Contact us for more information.
Novus Biologcials is part of the Bio-Techne family which includes: