| Description | TIRAP Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1 mg (lyophilized)DRQIKIWFQNRRMKWKK. Molecular weight: 2361. |
| Immunogen | Functions as a TIRAP decoy by binding to TIR interacting domains on specific TLR receptors. |
| Specificity | The TIRAP inhibitory peptide contains a protein transduction (PTD) sequence (DRQIKIWFQNRRMKWKK) derived from antennapedia which renders the peptide cell permeable.The control peptide consists of only the PTD sequence. |
| PreparationMethod | Preparation of 5 mM Stock SolutionsPBS* is added directly to the vials to prepare the stock solutions. Note: Bring the solution to room temperature and quick spin the tubes before opening the caps. TIRAP Inhibitor Peptide: 1 mg of DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS. Add 54 ul of PBS* to the vial to make a 5 mM stock solution. Mix by vortexing. Aliquot and store at -20C or -80C. Avoid repeated freeze thawing. Control Peptide: 1 mg of DRQIKIWFQNRRMKWKKAdd 84.8 ul PBS* to the vial. Mix by vortexing. Aliquot and store at 20C or -80C. Avoid repeated freeze thawing. Recipe for 1X PBS: 1. Dissolve the following in 800ml distilled H2O.- 8g of NaCl- 0.2g of KCl - 1.44g of Na2HPO4- 0.24g of KH2PO42. Adjust pH to 7.5 with HCl.3. Adjust volume to 1L with additional distilled H2O.4. Sterilize by autoclaving |
| Content | TIRAP Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1 mg (lyophilized)DRQIKIWFQNRRMKWKK. Molecular weight: 2361. |
| Gene | TIRAP |
| Application Notes | Inhibition of TIRAP binding to TLR2 or TLR4. | |
| Publications |
|
Accelerate Scientific Discovery by Developing Unique Products
The mission of Novus Biologicals, LLC is to accelerate scientific discovery by developing and marketing unique products for the lifesciences. Novus Biologicals is also organized to provide the biological research community with a mechanism for commercializing unique biological materials. We also focus on continually monitoring scientific trends and supply materials to serve these trends. By making these products widely available to institutional and commercial researchers, Novus Biologicals plays an important role in furthering biological research.
All of Novus Biologicals products are supplied with detailed technical information and ongoing support. By serving both niche and emerging markets, Novus Biologicals has built solid partnerships with our customers. Contact us for more information.
Novus Biologcials is part of the Bio-Techne family which includes:



