| Description | TLR2 / TLR4 Inhibitor Peptide: 1 mg (lyophilized); sequence: DRQIKIWFQNRRMKWKKPGFLRDPWCKYQML (Inhibitor sequence: PGFLRDPWCKYQML); Molecular weight: 4097.92 DaAntennapedia Control Peptide: 1 mg (lyophilized); sequence: DRQIKIWFQNRRMKWKK; Molecular weight: 2361 Da |
| Specificity | TLR2 and TLR4 Inhibitor Peptide: COBRA TLR2 and TLR4 Inhibitor interferes with interaction between TIRAP/Mal and TIR domain of TLR2 or TLR4. |
| PreparationMethod | Preparation of 2.5 mM peptide stock solutionsTLR2 / TLR4 Inhibitor Peptide: A final volume of 100 ul will make a 2.5 mM stock solution. Add 100 ul sterile water to the tube of peptide. Carefully pipet to ensure all of the peptide is dissolved and briefly spin the tube before opening.Antennapedia Control Peptide: A final volume of 170 ul will make a 2.5 mM stock solution. Add 170 ul sterile water to the tube of peptide. Carefully pipet to ensure all of the peptide is dissolved and briefly spin the tube before opening.The stock solutions may be diluted further to make working solutions. Dilute according to the needs for your assay. For example, dilute 2.5 mM stock solutions 1:10 in sterile 1X PBS or cell culture media to make 250 uM working solutions. Working solution should be made fresh daily and not be stored. |
| Gene | TIRAP |
| Application Notes | The inhibitor is used in assays to inhibit TLR2 and TLR4 signaling. We recommend an initial titration of the inhibitor from 0-50 uM for in vitro assays along with control of which concentrations should be mirror inhibitor concentrations. Inhibitor and control should be preincubated with cells prior to ligand activation to allow sufficient time for the peptides to enter from the media into the cell. We typically preincubate with inhibitor and control for 1 h prior to TLR2 or TLR4 activation (Figures 1 and 2); however, optimal preincubation times may vary between model systems. The TLR2/NF-kB/SEAPorter™ cell line and TLR4/MD2/CD14/NF-kB/SEAPorter™ cell line are a useful positive control model system for studying inhibition of TLR2 and TLR4 activation, respectively (Figures 1 through 3). Use in In vitro assay reported in scientific literature (PMID 26908090). Use in FLOW cytometry reported in scientific literature (PMID 27838489). | |
| Publications |
|
Accelerate Scientific Discovery by Developing Unique Products
The mission of Novus Biologicals, LLC is to accelerate scientific discovery by developing and marketing unique products for the lifesciences. Novus Biologicals is also organized to provide the biological research community with a mechanism for commercializing unique biological materials. We also focus on continually monitoring scientific trends and supply materials to serve these trends. By making these products widely available to institutional and commercial researchers, Novus Biologicals plays an important role in furthering biological research.
All of Novus Biologicals products are supplied with detailed technical information and ongoing support. By serving both niche and emerging markets, Novus Biologicals has built solid partnerships with our customers. Contact us for more information.
Novus Biologcials is part of the Bio-Techne family which includes:



